C1R, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C1R.

Brand:  Abnova PAB28388.100uL

Product Code. 16196700

Description

Sequence: PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC

Specifications

• Antigen: C1R
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant C1R.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: D3DUT5
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 715
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/ml) Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: C1R
• Gene Symbols: C1R
• Immunogen: Recombinant protein corresponding to amino acids of human C1R.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only