C17orf39, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C17orf39.

Brand:  Abnova PAB24319.100uL

Product Code. 16084697

Description

The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Sequence: DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE

Specifications

• Antigen: C17orf39
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant C17orf39.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8IVV7
• Gene Symbols: C17orf39
• Immunogen: Recombinant protein corresponding to amino acids of human C17orf39.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Gene: C17orf39
• Gene Alias: MGC3048
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 79018
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only