BTG2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant BTG2.

Brand:  Abnova PAB28556.100uL

Product Code. 16136840

Description

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq

Sequence: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG

Specifications

• Antigen: BTG2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant BTG2.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: P78543
• Gene Symbols: BTG2
• Immunogen: Recombinant protein corresponding to amino acids of recombinant BTG2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:200-1:500) Western Blot(1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: BTG2
• Gene Alias: MGC126063/MGC126064/PC3/TIS21
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 7832
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only