BRAP, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant BRAP.

Brand:  Abnova PAB27873.100uL

Product Code. 16196450

Description

The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm. [provided by RefSeq

Sequence: SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA

Specifications

• Antigen: BRAP
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant BRAP.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: BRAP2/IMP/RNF52
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 8315
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: BRAP
• Gene Symbols: BRAP
• Immunogen: Recombinant protein corresponding to amino acids of human BRAP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only