BFSP2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant BFSP2.

Brand:  Abnova PAB23290.100uL

Product Code. 16135840

Description

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and Dowling-Meara epidermolysis bullosa simplex. [provided by RefSeq

Sequence: LSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVE

Specifications

• Antigen: BFSP2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant BFSP2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q13515
• Gene Symbols: BFSP2
• Immunogen: Recombinant protein corresponding to amino acids of human BFSP2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: BFSP2
• Gene Alias: CP47/CP49/LIFL-L/MGC142078/MGC142080/PHAKOSIN
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 8419
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only