BCO2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant BCO2.

Brand:  Abnova PAB23586.100uL

Product Code. 16136090

Description

BCDO2 catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism (Kiefer et al., 2001 [PubMed 11278918]).[supplied by OMIM

Sequence: VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW

Specifications

• Antigen: BCO2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant BCO2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9BYV7
• Gene Symbols: BCO2
• Immunogen: Recombinant protein corresponding to amino acids of human BCO2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: BCO2
• Gene Alias: B-DIOX-II/BCDO2/FLJ34464
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 83875
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only