AURKA Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant AURKA.

Brand:  Abnova PAB28676.100uL

Product Code. 16186940

Description

The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL

Specifications

• Antigen: AURKA
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant AURKA.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene Alias: AIK/ARK1/AURA/AURORA2/BTAK/MGC34538/STK15/STK6/STK7
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 6790
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: AURKA
• Gene Symbols: AURKA
• Immunogen: Recombinant protein corresponding to amino acids of human AURKA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only