ATP7A, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ATP7A.

Brand:  Abnova PAB20632.100uL

Product Code. 16183680

Description

This gene encodes a transmembrane protein that functions in copper transport across membranes. The protein localizes to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. The protein relocalizes to the plasma membrane under conditions of elevated extracellular copper and functions in the efflux of copper from cells. Mutations in this gene result in Menkes disease, X-linked cutis laxa, and occipital horn syndrome. [provided by RefSeq

Sequence: TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELC

Specifications

• Antigen: ATP7A
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant ATP7A.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q04656
• Gene Symbols: ATP7A
• Immunogen: Recombinant protein corresponding to amino acids of human ATP7A.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Gene: ATP7A
• Gene Alias: FLJ17790/MK/MNK
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 538
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only