ARHGEF18, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ARHGEF18.

Brand:  Abnova PAB23969.100uL

Product Code. 16054537

Description

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI

Specifications

• Antigen: ARHGEF18
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant ARHGEF18.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q6ZSZ5
• Gene Symbols: ARHGEF18
• Immunogen: Recombinant protein corresponding to amino acids of human ARHGEF18.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: ARHGEF18
• Gene Alias: KIAA0521/MGC15913/P114-RhoGEF
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 23370
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only