AQP6, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant AQP6.

Brand:  Abnova PAB21937.100uL

Product Code. 16114750

Description

The protein encoded by this gene is an aquaporin protein, which functions as a water channel in cells. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This protein is specific for the kidney. This gene and related family members AQP0, AQP2, and AQP5 reside in a cluster on chromosome 12q13. [provided by RefSeq

Sequence: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME

Specifications

• Antigen: AQP6
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant AQP6.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q13520
• Gene Symbols: AQP6
• Immunogen: Recombinant protein corresponding to amino acids of human AQP6.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: AQP6
• Gene Alias: AQP2L/KID
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 363
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only