missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB5C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
£188.00 - £427.00
Specifications
| Antigen | RAB5C |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477880
|
Novus Biologicals
NBP1-80858-25ul |
25ul |
£188.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18218315
|
Novus Biologicals
NBP1-80858 |
0.1 mL |
£427.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RAB5C Polyclonal specifically detects RAB5C in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| RAB5C | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| L1880, MGC117217, RAB5C, member of RAS oncogene family, RAB5C, member RAS oncogene family, RAB5CL, RAB5L, RABLMGC138857, ras-related protein Rab-5C | |
| RAB5C | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| P51148 | |
| 5878 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title