Rab5a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58880

Product Code. 18226603

Description

Rab5a Polyclonal specifically detects Rab5a in Human, Mouse, Mammal, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Rab5a
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: RAB5A, member RAS oncogene family, RAB5RAS-associated protein RAB5A, ras-related protein Rab-5A
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Chicken: 85%; Pig: 78%; Sheep: 78%.
• Target Species: Human, Mouse, Mammalia, Zebrafish, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500
• Gene Accession No.: P20339
• Gene Symbols: RAB5A
• Immunogen: Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family). The peptide sequence was selected from the middle region of RAB5A. Peptide sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS.
• Quantity: 100 μL
• Research Discipline: Endosome Markers, Signal Transduction
• Gene ID (Entrez): 5868
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only