missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RAB38 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RAB38 Polyclonal specifically detects RAB38 in Human samples. It is validated for Western Blot.Specifications
| RAB38 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Melanoma antigen NY-MEL-1, NY-MEL-1, RAB38, member RAS oncogene family, Rab-related GTP-binding protein, ras-related protein Rab-38, rrGTPbp | |
| RAB38 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P57729 | |
| 23682 | |
| Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title