missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35676-20ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
RAB26 Polyclonal antibody specifically detects RAB26 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
| RAB26 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| RAB26, member RAS oncogene family, Ras-related oncogene protein, ras-related protein Rab-26, V46133 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).,, Sequence:, MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY | |
| 20 μL | |
| Signal Transduction | |
| 25837 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu