missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35676-20ul
This item is not returnable.
View return policy
Description
RAB26 Polyclonal antibody specifically detects RAB26 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| RAB26 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| RAB26, member RAS oncogene family, Ras-related oncogene protein, ras-related protein Rab-26, V46133 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).,, Sequence:, MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY | |
| 20 μL | |
| Signal Transduction | |
| 25837 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction