RAB14 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93227-0.1ml

Product Code. 18697090

Description

RAB14 Polyclonal antibody specifically detects RAB14 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: RAB14
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000
• Gene Alias: bA165P4.3 (member RAS oncogene family), F protein-binding protein 1, FBP, RAB-14, RAB14, member RAS oncogene family, ras-related protein Rab-14, small GTP binding protein RAB14
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 39-140 of human RAB14 (NP_057406.2). DCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51552
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified