missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAB11FIP5 Antibody, Novus Biologicals™

RAB11FIP5 Antibody, Novus Biologicals™

Product Code. 18429820 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18429820 25 μL 25µL
18057583 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18429820 Supplier Novus Biologicals Supplier No. NBP18185525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

RAB11FIP5 Polyclonal specifically detects RAB11FIP5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAB11FIP5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9BXF6
Gene Alias DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5
Gene Symbols RAB11FIP5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQEL
Molecular Weight of Antigen 70 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26056
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.