missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB11FIP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£342.00 - £470.00
Specifications
| Antigen | RAB11FIP3 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18428720
|
Novus Biologicals
NBP1-84000-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18209046
|
Novus Biologicals
NBP1-84000 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RAB11FIP3 Polyclonal specifically detects RAB11FIP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RAB11FIP3 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9727 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ARFO1, Arfophilin-1, EF hands-containing Rab-interacting protein, Eferin, FIP3-Rab11, KIAA0665arfophilin-1, MU-MB-17.148, PAC196A12.1, RAB11 family interacting protein 3 (class II), rab11-family interacting protein 3, Rab11-FIP3rab11 family-interacting protein 3 | |
| RAB11FIP3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title