missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rab11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58933
This item is not returnable.
View return policy
Description
Rab11 Polyclonal antibody specifically detects Rab11 in Human samples. It is validated for Western Blot.
Specifications
| Rab11 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| GTP-binding protein YPT3, H-YPT3, MGC133246, RAB11B, member of RAS oncogene family, RAB11B, member RAS oncogene family, ras-related protein Rab-11B, YPT3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Goat: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Goat, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q15907 | |
| RAB11B | |
| Synthetic peptides corresponding to RAB11B(RAB11B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB11B. Peptide sequence IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV. | |
| 100 μL | |
| Signal Transduction | |
| 9230 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction