missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
QTRTD1 Polyclonal specifically detects QTRTD1 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | QTRTD1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 2.4.2.29, FLJ12960, queuine tRNA-ribosyltransferase domain containing 1, Queuine tRNA-ribosyltransferase domain-containing protein 1, queuine tRNA-ribosyltransferase subunit QTRTD1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human QTRTD1 (NP_001243764.1). Peptide sequence SFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEK |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?