missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ PYY Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579900
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse pancreas tissue, mouse intestine tissue, mouse intestine tissue, rat intestine tissue, rat pancreas tissue.
Peptide tyrosine-tyrosine amide (3-36), or PYY (3-36), is a major metabolite of the gut hormone PYY and is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in the circulation. PYY (3-36) is a potent inhibitor of food intake in rats and humans, acting selectively on the Y2 receptor to inhibit orexigenic NPY neurons in the arcuate nucleus, thus disinhibiting anorexigenic POMC neurons. The anorexigenic effect of PYY (3-36) is additive to that of the co-secreted gut hormone GLP-1.
Specifications
| PYY | |
| Polyclonal | |
| Unconjugated | |
| Pyy | |
| GHYY; Peptide tyrosine tyrosine; peptide tyrosine-tyrosine (YY); peptide YY; peptide YY (mapped); Peptide YY(3-36); Peptide YY3-36; Peptide YY3-37; peptide-YY; prepro-PYY; PYY; PYY II; PYY1; PYY-1; PYY-2; PYYI; PYY-I; PYYII; PYY-II; RATGHYY; Yy | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 217212, 287730 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.01mg sodium azide | |
| P10631, Q9EPS2 | |
| Pyy | |
| A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY). | |
| 100 μg | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction