Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18432401	Novus Biologicals NBP1-87309-25ul	25 μL
18252778	Novus Biologicals NBP1-87309	0.1 mL

Description

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Polyclonal specifically detects Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54704
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, EC 3.1.3, EC 3.1.3.43, MGC119646, PDH, PDP 1, PDPC, PDPC 1, PDPFLJ32517, PPM2CFLJ56179, Protein phosphatase 2C, protein phosphatase 2C, magnesium-dependent, catalytic subunit, pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase, Pyruvate dehydrogenase phosphatase catalytic subunit 1, pyruvate dehyrogenase phosphatase catalytic subunit 1
• Gene Symbols: PDP1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only