missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PYK2/FAK2 Antibody, Novus Biologicals™

PYK2/FAK2 Antibody, Novus Biologicals™

Product Code. 18430422 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18430422 25 μL 25µL
18353431 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18430422 Supplier Novus Biologicals Supplier No. NBP19122825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

PYK2/FAK2 Polyclonal specifically detects PYK2/FAK2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PYK2/FAK2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CADTKCAK-beta, CAK beta, CAKB, Calcium-dependent tyrosine kinase, Cell adhesion kinase beta, EC 2.7.10, FADK2, FAK2EC 2.7.10.2, Focal adhesion kinase 2, PKB, Proline-rich tyrosine kinase 2, protein kinase B, protein tyrosine kinase 2 beta, protein-tyrosine kinase 2-beta, PTK, PTK2B protein tyrosine kinase 2 beta, PYK2Related adhesion focal tyrosine kinase, RAFTKFADK 2
Gene Symbols PTK2B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Cancer, Cellular Markers, Protein Kinase, Signal Transduction, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 2185
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.