missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PWWP2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88764
This item is not returnable.
View return policy
Description
PWWP2B Polyclonal antibody specifically detects PWWP2B in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| PWWP2B | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| bA432J24.1, FLJ39621, FLJ46823, pp8607, PWWP domain containing 2, PWWP domain containing 2B, PWWP domain-containing protein 2B, PWWP2, RP11-273H7.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPEIRE | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 170394 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction