missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PWP2H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PWP2H |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PWP2H Polyclonal specifically detects PWP2H in Human samples. It is validated for Western Blot.Specifications
| PWP2H | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17 | |
| PWP2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q15269 | |
| 5822 | |
| Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title