missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PUS10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30613-25ul
This item is not returnable.
View return policy
Description
PUS10 Polyclonal specifically detects PUS10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PUS10 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q3MIT2 | |
| PUS10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 150962 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction