missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PUS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38575-20ul
This item is not returnable.
View return policy
Description
PUS1 Polyclonal antibody specifically detects PUS1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| PUS1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 5.4.99.12, MGC11268, mitochondrial tRNA pseudouridine synthase A, MLASA1, pseudouridylate synthase 1, tRNA pseudouridine synthase A, mitochondrial, tRNA pseudouridylate synthase I, tRNA uridine isomerase I, tRNA-uridine isomerase I | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2).,, Sequence:, YAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD | |
| 20 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 80324 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction