PUM2, Mouse anti-Human, Clone: 1E10, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00023369-M07.100ug

Product Code. 16075325

Description

Sequence: KLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGLGPLPN

Specifications

• Antigen: PUM2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: pumilio homolog 2 (Drosophila)
• Gene Alias: FLJ36528/KIAA0235/MGC138251/MGC138253/PUMH2/PUML2
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1E10
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_015317
• Gene Symbols: PUM2
• Immunogen: PUM2 (NP_056132, 106 a.a. ∼ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 23369
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ