missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PUM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | PUM2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18232095
|
Novus Biologicals
NBP2-56823 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659828
|
Novus Biologicals
NBP2-56823-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PUM2 Polyclonal specifically detects PUM2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PUM2 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers, Translation Control | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23369 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ36528, KIAA0235PUMH2PUML2, MGC138251, MGC138253, pumilio (Drosphila) homolog 2, pumilio homolog 2, pumilio homolog 2 (Drosophila), Pumilio-2 | |
| PUM2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title