missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PUF60 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | PUF60 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PUF60 Polyclonal specifically detects PUF60 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PUF60 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, siah-BP1, SIAHBP1pyrimidine tract binding splicing factor | |
| PUF60 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q9UHX1-2 | |
| 22827 | |
| Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title