missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTTG1IP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | PTTG1IP |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18298091
|
Novus Biologicals
NBP2-57370 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663369
|
Novus Biologicals
NBP2-57370-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTTG1IP Polyclonal specifically detects PTTG1IP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PTTG1IP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein, PBFPTTG-binding factor, pituitary tumor-transforming 1 interacting protein, Pituitary tumor-transforming gene protein-binding factor | |
| PTTG1IP | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 754 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto