missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PTPN12 Monoclonal antibody specifically detects PTPN12 in Human samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | PTPN12 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Clone | 4G6 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_002826 |
| Gene Alias | protein tyrosine phosphatase, non-receptor type 12, Protein-tyrosine phosphatase G1, PTPG1tyrosine-protein phosphatase non-receptor type 12, PTP-PESTEC 3.1.3.48 |
| Host Species | Mouse |
| Immunogen | PTPN12 (NP_002826.2, 682 a.a. ∽ 779 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?