missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PTP rho/PTPRT Polyclonal specifically detects PTP rho/PTPRT in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | PTP rho/PTPRT |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 3.1.3, EC 3.1.3.48, KIAA0283RPTPrho, protein tyrosine phosphatase, receptor type, T, receptor protein tyrosine phosphatase, Receptor-type tyrosine-protein phosphatase rho, receptor-type tyrosine-protein phosphatase T, RPTP-rho, R-PTP-T |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PTP rho/PTPRT (NP_008981.4). Peptide sequence QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?