missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTP pi/PTPRU Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £513.00
Specifications
| Antigen | PTP pi/PTPRU |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18470271
|
Novus Biologicals
NBP1-81873-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18259735
|
Novus Biologicals
NBP1-81873 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTP pi/PTPRU Polyclonal specifically detects PTP pi/PTPRU in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PTP pi/PTPRU | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10076 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FMI, hPTP-J, pancreatic carcinoma phosphatase 2, PCP2, PCP-2, pi R-PTP-Psi, protein tyrosine phosphatase J, protein tyrosine phosphatase, receptor type, U, protein-tyrosine phosphatase J, protein-tyrosine phosphatase pi, PTP, PTP pi, PTP-J, PTP-PI, PTPPSI, PTP-RO, Receptor protein tyrosine phosphatase hPTP-J, R-PTP-PSI | |
| PTPRU | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title