missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18349296

PTHLH/PTHrP Antibody, Novus Biologicals™

Product Code. 18349296 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349296 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18349296 Supplier Novus Biologicals Supplier No. NBP303168

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PTHLH/PTHrP Polyclonal specifically detects PTHLH/PTHrP in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PTHLH/PTHrP
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:1000, Flow Cytometry 1:20-1:50, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias BDE2, HHM, MGC14611, parathyroid hormone-like hormone, Parathyroid hormone-like protein, parathyroid hormone-related protein, PLPosteostatin, PTHR, PTH-related protein, PTHrP, PTH-rP, PTHRPparathyroid hormone-like related protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 74-130 of human PTHLH/PTHrP (NP_945316.1). ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Biologically Active Proteins, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 5744
Target Species Human, Mouse
Content And Storage Store at 4°C. Do not freeze.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.