missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PTH1R/PTHR1 Polyclonal antibody specifically detects PTH1R/PTHR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | PTH1R/PTHR1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | MGC138426, parathyroid hormone 1 receptorMGC138452, parathyroid hormone/parathyroid hormone-related peptide receptor, parathyroid hormone/parathyroid hormone-related protein receptor, PFE, PTH/PTHr receptor, PTH/PTHrP type I receptor, PTH1 receptor, PTHRPTHR1parathyroid hormone receptor 1, seven transmembrane helix receptor |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDH |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?