missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTGER2 Rabbit anti-Human, Mouse, Rat, Clone: 2G10L6, Novus Biologicals™
Shop All Bio Techne ProductsDescription
PTGER2 Monoclonal antibody specifically detects PTGER2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | PTGER2 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 2G10L6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | EP2, PGE receptor EP2 subtype, PGE2 receptor EP2 subtype, prostaglandin E receptor 2 (subtype EP2), 53kD, prostaglandin E receptor 2 (subtype EP2), 53kDa, prostaglandin E2 receptor EP2 subtype, Prostanoid EP2 receptor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 259-358 of human PTGER2 (P43116). ETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?