PTGER1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94106-0.1ml

Product Code. 18699151

Description

PTGER1 Polyclonal antibody specifically detects PTGER1 in Mouse samples. It is validated for Western Blot

Specifications

• Antigen: PTGER1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: EP1, PGE receptor EP1 subtype, PGE receptor, EP1 subtype, PGE2 receptor EP1 subtype, prostaglandin E receptor 1 (subtype EP1), 42kD, prostaglandin E receptor 1 (subtype EP1), 42kDa, prostaglandin E receptor 1, subtype EP1, prostaglandin E2 receptor EP1 subtype, Prostanoid EP1 receptor
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PTGER1 (P34995). VYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
• Quantity: 0.1 mL
• Research Discipline: Cancer, GPCR, Signal Transduction
• Gene ID (Entrez): 5731
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified