missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTGER1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94106-0.1ml
This item is not returnable.
View return policy
Description
PTGER1 Polyclonal antibody specifically detects PTGER1 in Mouse samples. It is validated for Western Blot
Specifications
| PTGER1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EP1, PGE receptor EP1 subtype, PGE receptor, EP1 subtype, PGE2 receptor EP1 subtype, prostaglandin E receptor 1 (subtype EP1), 42kD, prostaglandin E receptor 1 (subtype EP1), 42kDa, prostaglandin E receptor 1, subtype EP1, prostaglandin E2 receptor EP1 subtype, Prostanoid EP1 receptor | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PTGER1 (P34995). VYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF | |
| 0.1 mL | |
| Cancer, GPCR, Signal Transduction | |
| 5731 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction