missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18418098

PTF1A Antibody (1B8), Novus Biologicals™

Product Code. 18418098 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18418098 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18418098 Supplier Novus Biologicals Supplier No. H00256297M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PTF1A Monoclonal antibody specifically detects PTF1A in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PTF1A
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1B8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_835455
Gene Alias bHLH transcription factor p48, BHLHA29, bHLHa29exocrine pancreas-specific transcription factor p48, Class A basic helix-loop-helix protein 29, p48 DNA-binding subunit of transcription factor PTF1, pancreas specific transcription factor, 1a, pancreas transcription factor 1 subunit alpha, Pancreas-specific transcription factor 1a, PTF1P48, PTF1-p48class II bHLH protein PTF1A
Host Species Mouse
Immunogen PTF1A (NP_835455, 250 a.a. ∽ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 256297
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.