missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTDSS1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | PTDSS1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PTDSS1 Polyclonal antibody specifically detects PTDSS1 in Human samples. It is validated for Western BlotSpecifications
| PTDSS1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 9791 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| KIAA0024Serine-exchange enzyme I, phosphatidylserine synthase 1, PSS1EC 2.7.8.-, PSSAPSS-1, PtdSer synthase 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PTDSS1 (NP_055569.1). MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRDDSVPEDNIW | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title