missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PTCRA Polyclonal antibody specifically detects PTCRA in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | PTCRA |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | pre T-cell antigen receptor alpha, PTA, PT-ALPHA |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 172-281 of human PTCRA (NP_612153.2). LCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?