missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PSMG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PSMG1 Polyclonal specifically detects PSMG1 in Human samples. It is validated for Western Blot.Specifications
| PSMG1 | |
| Polyclonal | |
| Rabbit | |
| O95456 | |
| 8624 | |
| Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C21-LRP, C21LRPc21-LRP, Chromosome 21 leucine-rich protein, Down syndrome critical region gene 2, DSCR2leucine rich protein C21-LRP, LRPC21, PAC-1, PAC1Down syndrome critical region protein 2, proteasome (prosome, macropain) assembly chaperone 1, proteasome assembling chaperone 1, proteasome assembly chaperone 1 | |
| PSMG1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title