PSMD6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-81545

Product Code. 18237016

Description

PSMD6 Polyclonal specifically detects PSMD6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMD6
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: 26S proteasome non-ATPase regulatory subunit 6, Breast cancer-associated protein SGA-113M, KIAA010726S proteasome regulatory subunit S10, p42A, p44S10, PFAAP4, Phosphonoformate immuno-associated protein 4, proteasome (prosome, macropain) 26S subunit, non-ATPase, 6,26S proteasome regulatory subunit RPN7, Proteasome regulatory particle subunit p44S10, Rpn7, S10, SGA-113M
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9861
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PSMD6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human PSMD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only