missing translation for 'onlineSavingsMsg'
Learn More

PSMB10/MECL1 Antibody, Novus Biologicals™

Product Code. 18635235 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18635235 25 μL 25µL
18197538 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18635235 Supplier Novus Biologicals Supplier No. NBP23815525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PSMB10/MECL1 Polyclonal specifically detects PSMB10/MECL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PSMB10/MECL1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P40306
Gene Alias beta2i, FLJ00366, LMP10Proteasome subunit beta-2i, Low molecular mass protein 10, Macropain subunit MECl-1, MECL1EC 3.4.25.1, MGC1665, Multicatalytic endopeptidase complex subunit MECl-1, proteasome (prosome, macropain) subunit, beta type, 10, proteasome catalytic subunit 2i, Proteasome MECl-1, proteasome subunit beta 7i, proteasome subunit beta type-10, proteasome subunit MECL1
Gene Symbols PSMB10
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 5699
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.