PSMB10/MECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18433391	Novus Biologicals NBP1-88660-25ul	25 μL
18790524	Novus Biologicals NBP1-88660	0.1 mL

Description

PSMB10/MECL1 Polyclonal specifically detects PSMB10/MECL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMB10/MECL1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: beta2i, FLJ00366, LMP10Proteasome subunit beta-2i, Low molecular mass protein 10, Macropain subunit MECl-1, MECL1EC 3.4.25.1, MGC1665, Multicatalytic endopeptidase complex subunit MECl-1, proteasome (prosome, macropain) subunit, beta type, 10, proteasome catalytic subunit 2i, Proteasome MECl-1, proteasome subunit beta 7i, proteasome subunit beta type-10, proteasome subunit MECL1
• Gene Symbols: PSMB10
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500-1:5000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5699
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only