Invitrogen™ PSMA3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579890

Product Code. 15945455

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, mouse lung tissue, 293T whole cell. IHC: mouse brain tissue, rat brain tissue, human intestinal cancer tissue. Flow: HeLa cell.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Specifications

• Antigen: PSMA3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Psma3
• Gene Alias: HC8; Lmpc8; Macropain subunit C8; multicatalytic endopeptidase complex subunit C8; multicatalytic proteinase subunit K; proteasome (prosome, macropain) subunit, alpha type 3; proteasome (prosome, macropain) subunit, alpha type, 3; proteasome component C8; proteasome subunit alpha 3; proteasome subunit alpha type-3; proteasome subunit C8; proteasome subunit K; PSA3; PSC3; PSC8; PSMA3; Psma3l; testicular secretory protein Li 43
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19167, 29670, 5684
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O70435, P18422, P25788
• Gene Symbols: Psma3
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG