missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSG5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PSG5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PSG5 Polyclonal specifically detects PSG5 in Human samples. It is validated for Western Blot.Specifications
| PSG5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Fetal liver non-specific cross-reactive antigen 3, FL-NCA-3PSG, pregnancy specific beta-1-glycoprotein 5, pregnancy-specific beta 1 glycoprotein, pregnancy-specific beta-1 glycoprotein, pregnancy-specific beta-1-glycoprotein 5, Pregnancy-specific beta-1-glycoprotein-5, Pregnancy-specific glycoprotein 5, PS-beta-G-5, PSBG-5 | |
| PSG5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q15238 | |
| 5673 | |
| Synthetic peptides corresponding to PSG5(pregnancy specific beta-1-glycoprotein 5) The peptide sequence was selected from the middle region of PSG5. Peptide sequence SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title