missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
PRSS37 Polyclonal specifically detects PRSS37 in Human samples. It is validated for Immunohistochemistry.
Specifica
Specifica
| Antigen | PRSS37 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Peptidase S1 domain-containing protein LOC136242, probable inactive serine protease 37, Probable inactive trypsin-X2, protease, serine, 37, TRYX2 |
| Gene Symbols | PRSS37 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?