PRRC2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57275-25ul

Product Code. 18628928

Description

PRRC2B Polyclonal specifically detects PRRC2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PRRC2B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: BAT2L, DKFZp781F05101, HLA-B associated transcript 2-like 1, HLA-B-associated transcript 2-like 1, LQFBS-1, MGC10526, proline-rich coiled-coil 2B, proline-rich coiled-coil protein 2B, protein BAT2-like 1, protein PRRC2B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84726
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PRRC2B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only