missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRR5L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | PRR5L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PRR5L Polyclonal specifically detects PRR5L in Human samples. It is validated for Western Blot.Specifications
| PRR5L | |
| Polyclonal | |
| Rabbit | |
| Q6MZQ0 | |
| 79899 | |
| Synthetic peptides corresponding to FLJ14213(protor-2) The peptide sequence was selected from the middle region of FLJ14213. Peptide sequence LNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14213MGC16218, FLJ22630, proline rich 5 like, Protein observed with Rictor-2, protor-2, PROTOR2proline-rich protein 5-like | |
| PRR5L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title